ZBTB49,FLJ38559
  • ZBTB49,FLJ38559

Anti-ZBTB49 Antibody 100ul

Ref: AN-HPA024450-100ul
Anti-ZBTB49

Información del producto

Polyclonal Antibody against Human ZBTB49, Gene description: zinc finger and BTB domain containing 49, Alternative Gene Names: FLJ38559, ZNF509, Validated applications: ICC, IHC, WB, Uniprot ID: Q6ZSB9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZBTB49
Gene Description zinc finger and BTB domain containing 49
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications ICC, IHC, WB
Sequence AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVISENYP
Immunogen AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVISENYP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ38559, ZNF509
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZSB9
HTS Code 3002150000
Gene ID 166793
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZBTB49 Antibody 100ul

Anti-ZBTB49 Antibody 100ul