TSR1,FLJ10534
  • TSR1,FLJ10534

Anti-TSR1 Antibody 100ul

Ref: AN-HPA024434-100ul
Anti-TSR1

Información del producto

Polyclonal Antibody against Human TSR1, Gene description: TSR1, 20S rRNA accumulation, homolog (S. cerevisiae), Alternative Gene Names: FLJ10534, Validated applications: IHC, WB, Uniprot ID: Q2NL82, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSR1
Gene Description TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EKYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKE
Immunogen EKYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10534
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q2NL82
HTS Code 3002150000
Gene ID 55720
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TSR1 Antibody 100ul

Anti-TSR1 Antibody 100ul