IL33,C9orf26
  • IL33,C9orf26

Anti-IL33 Antibody 25ul

Ref: AN-HPA024426-25ul
Anti-IL33

Información del producto

Polyclonal Antibody against Human IL33, Gene description: interleukin 33, Alternative Gene Names: C9orf26, DKFZp586H0523, DVS27, IL1F11, NF-HEV, Validated applications: IHC, Uniprot ID: O95760, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IL33
Gene Description interleukin 33
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence STVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDG
Immunogen STVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf26, DKFZp586H0523, DVS27, IL1F11, NF-HEV
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95760
HTS Code 3002150000
Gene ID 90865
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IL33 Antibody 25ul

Anti-IL33 Antibody 25ul