LURAP1L,bA3L8.2
  • LURAP1L,bA3L8.2

Anti-LURAP1L Antibody 100ul

Ref: AN-HPA024407-100ul
Anti-LURAP1L

Información del producto

Polyclonal Antibody against Human LURAP1L, Gene description: leucine rich adaptor protein 1-like, Alternative Gene Names: bA3L8.2, C9orf150, FLJ38505, MGC46502, Validated applications: ICC, IHC, WB, Uniprot ID: Q8IV03, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LURAP1L
Gene Description leucine rich adaptor protein 1-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence KVPESLVRSLRGEEPVPRERDRDPCGGSGGGGGGGGGCSSSSSYCSFPPSLSSSSSSSPTSGSPRGSHSSALERLETKLHLLRQEMVNLRATDVRLMRQLLVINESIESIKW
Immunogen KVPESLVRSLRGEEPVPRERDRDPCGGSGGGGGGGGGCSSSSSYCSFPPSLSSSSSSSPTSGSPRGSHSSALERLETKLHLLRQEMVNLRATDVRLMRQLLVINESIESIKW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA3L8.2, C9orf150, FLJ38505, MGC46502
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IV03
HTS Code 3002150000
Gene ID 286343
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LURAP1L Antibody 100ul

Anti-LURAP1L Antibody 100ul