DSCC1,DCC1,hDCC1
  • DSCC1,DCC1,hDCC1

Anti-DSCC1 Antibody 100ul

Ref: AN-HPA024401-100ul
Anti-DSCC1

Información del producto

Polyclonal Antibody against Human DSCC1, Gene description: DNA replication and sister chromatid cohesion 1, Alternative Gene Names: DCC1, hDCC1, MGC5528, Validated applications: ICC, WB, Uniprot ID: Q9BVC3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DSCC1
Gene Description DNA replication and sister chromatid cohesion 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence KLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQ
Immunogen KLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DCC1, hDCC1, MGC5528
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BVC3
HTS Code 3002150000
Gene ID 79075
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DSCC1 Antibody 100ul

Anti-DSCC1 Antibody 100ul