RPH3AL,Noc2
  • RPH3AL,Noc2

Anti-RPH3AL Antibody 100ul

Ref: AN-HPA024311-100ul
Anti-RPH3AL

Información del producto

Polyclonal Antibody against Human RPH3AL, Gene description: rabphilin 3A-like (without C2 domains), Alternative Gene Names: Noc2, Validated applications: IHC, Uniprot ID: Q9UNE2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RPH3AL
Gene Description rabphilin 3A-like (without C2 domains)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQQRIGRLVERLETMRRNVMGNG
Immunogen QLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQQRIGRLVERLETMRRNVMGNG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Noc2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UNE2
HTS Code 3002150000
Gene ID 9501
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPH3AL Antibody 100ul

Anti-RPH3AL Antibody 100ul