TACO1,CCDC44
  • TACO1,CCDC44

Anti-TACO1 Antibody 100ul

Ref: AN-HPA024294-100ul
Anti-TACO1

Información del producto

Polyclonal Antibody against Human TACO1, Gene description: translational activator of mitochondrially encoded cytochrome c oxidase I, Alternative Gene Names: CCDC44, Validated applications: IHC, WB, Uniprot ID: Q9BSH4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TACO1
Gene Description translational activator of mitochondrially encoded cytochrome c oxidase I
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SNSSHKCQADIRHILNKNGGVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMAIEAGAEDVKETEDE
Immunogen SNSSHKCQADIRHILNKNGGVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMAIEAGAEDVKETEDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCDC44
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BSH4
HTS Code 3002150000
Gene ID 51204
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TACO1 Antibody 100ul

Anti-TACO1 Antibody 100ul