FAM71F2,FAM137B
  • FAM71F2,FAM137B

Anti-FAM71F2 Antibody 25ul

Ref: AN-HPA024248-25ul
Anti-FAM71F2

Información del producto

Polyclonal Antibody against Human FAM71F2, Gene description: family with sequence similarity 71, member F2, Alternative Gene Names: FAM137B, Validated applications: IHC, Uniprot ID: Q6NXP2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM71F2
Gene Description family with sequence similarity 71, member F2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ADRNNDTAIEIDNCSSYKIPSPVASPINLNIPMRAALSHSLWEQEDWNEHLLQVHIASYLGEHFLGA
Immunogen ADRNNDTAIEIDNCSSYKIPSPVASPINLNIPMRAALSHSLWEQEDWNEHLLQVHIASYLGEHFLGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM137B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6NXP2
HTS Code 3002150000
Gene ID 346653
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM71F2 Antibody 25ul

Anti-FAM71F2 Antibody 25ul