CCDC171,bA536D16.1
  • CCDC171,bA536D16.1

Anti-CCDC171 Antibody 100ul

Ref: AN-HPA024133-100ul
Anti-CCDC171

Información del producto

Polyclonal Antibody against Human CCDC171, Gene description: coiled-coil domain containing 171, Alternative Gene Names: bA536D16.1, bA778P13.1, C9orf93, Em:AL513423.1, FLJ39267, FLJ46740, Validated applications: ICC, IHC, Uniprot ID: Q6TFL3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC171
Gene Description coiled-coil domain containing 171
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ASTRIMTLEKEMTSHRSHIAALKSELHTACLRENASLQSIGSRDHSNLSIPSRAPLPADTTGIGDFLPLKAELDTTYTFLKETFINTVPHALTSSHSSPVTMSANANRPTQI
Immunogen ASTRIMTLEKEMTSHRSHIAALKSELHTACLRENASLQSIGSRDHSNLSIPSRAPLPADTTGIGDFLPLKAELDTTYTFLKETFINTVPHALTSSHSSPVTMSANANRPTQI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA536D16.1, bA778P13.1, C9orf93, Em:AL513423.1, FLJ39267, FLJ46740
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6TFL3
HTS Code 3002150000
Gene ID 203238
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCDC171 Antibody 100ul

Anti-CCDC171 Antibody 100ul