PFDN4,C-1,C1,PFD4
  • PFDN4,C-1,C1,PFD4

Anti-PFDN4 Antibody 100ul

Ref: AN-HPA024055-100ul
Anti-PFDN4

Información del producto

Polyclonal Antibody against Human PFDN4, Gene description: prefoldin subunit 4, Alternative Gene Names: C-1, C1, PFD4, Validated applications: IHC, WB, Uniprot ID: Q9NQP4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PFDN4
Gene Description prefoldin subunit 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence DVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFG
Immunogen DVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C-1, C1, PFD4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQP4
HTS Code 3002150000
Gene ID 5203
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PFDN4 Antibody 100ul

Anti-PFDN4 Antibody 100ul