OTUD6B,CGI-77,DUBA5
  • OTUD6B,CGI-77,DUBA5

Anti-OTUD6B Antibody 100ul

Ref: AN-HPA024046-100ul
Anti-OTUD6B

Información del producto

Polyclonal Antibody against Human OTUD6B, Gene description: OTU domain containing 6B, Alternative Gene Names: CGI-77, DUBA5, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N6M0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OTUD6B
Gene Description OTU domain containing 6B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence IQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLV
Immunogen IQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-77, DUBA5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N6M0
HTS Code 3002150000
Gene ID 51633
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OTUD6B Antibody 100ul

Anti-OTUD6B Antibody 100ul