ALOX12B,12R-LOX
  • ALOX12B,12R-LOX

Anti-ALOX12B Antibody 100ul

Ref: AN-HPA024002-100ul
Anti-ALOX12B

Información del producto

Polyclonal Antibody against Human ALOX12B, Gene description: arachidonate 12-lipoxygenase, 12R type, Alternative Gene Names: 12R-LOX, Validated applications: ICC, IHC, Uniprot ID: O75342, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ALOX12B
Gene Description arachidonate 12-lipoxygenase, 12R type
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI
Immunogen LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 12R-LOX
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75342
HTS Code 3002150000
Gene ID 242
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ALOX12B Antibody 100ul

Anti-ALOX12B Antibody 100ul