DHRS4,FLJ11008
  • DHRS4,FLJ11008

Anti-DHRS4 Antibody 100ul

Ref: AN-HPA023972-100ul
Anti-DHRS4

Información del producto

Polyclonal Antibody against Human DHRS4, Gene description: dehydrogenase/reductase (SDR family) member 4, Alternative Gene Names: FLJ11008, humNRDR, SCAD-SRL, SDR-SRL, SDR25C2, Validated applications: IHC, WB, Uniprot ID: Q9BTZ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DHRS4
Gene Description dehydrogenase/reductase (SDR family) member 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGT
Immunogen SIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11008, humNRDR, SCAD-SRL, SDR-SRL, SDR25C2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BTZ2
HTS Code 3002150000
Gene ID 10901
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DHRS4 Antibody 100ul

Anti-DHRS4 Antibody 100ul