PAGE4,CT16.7,GAGEC1
  • PAGE4,CT16.7,GAGEC1

Anti-PAGE4 Antibody 100ul

Ref: AN-HPA023880-100ul
Anti-PAGE4

Información del producto

Polyclonal Antibody against Human PAGE4, Gene description: P antigen family, member 4 (prostate associated), Alternative Gene Names: CT16.7, GAGEC1, PAGE-4, Validated applications: IHC, Uniprot ID: O60829, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PAGE4
Gene Description P antigen family, member 4 (prostate associated)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Immunogen DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT16.7, GAGEC1, PAGE-4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60829
HTS Code 3002150000
Gene ID 9506
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PAGE4 Antibody 100ul

Anti-PAGE4 Antibody 100ul