MMP16,C8orf57
  • MMP16,C8orf57

Anti-MMP16 Antibody 100ul

Ref: AN-HPA023693-100ul
Anti-MMP16

Información del producto

Polyclonal Antibody against Human MMP16, Gene description: matrix metallopeptidase 16 (membrane-inserted), Alternative Gene Names: C8orf57, DKFZp761D112, MT3-MMP, Validated applications: IHC, Uniprot ID: P51512, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MMP16
Gene Description matrix metallopeptidase 16 (membrane-inserted)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCD
Immunogen TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C8orf57, DKFZp761D112, MT3-MMP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51512
HTS Code 3002150000
Gene ID 4325
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MMP16 Antibody 100ul

Anti-MMP16 Antibody 100ul