DAP3,bMRP-10,DAP-3
  • DAP3,bMRP-10,DAP-3

Anti-DAP3 Antibody 100ul

Ref: AN-HPA023687-100ul
Anti-DAP3

Información del producto

Polyclonal Antibody against Human DAP3, Gene description: death associated protein 3, Alternative Gene Names: bMRP-10, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29, Validated applications: ICC, IHC, WB, Uniprot ID: P51398, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DAP3
Gene Description death associated protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, IHC, ICC
Sequence GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEF
Immunogen GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bMRP-10, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51398
HTS Code 3002150000
Gene ID 7818
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DAP3 Antibody 100ul

Anti-DAP3 Antibody 100ul