FBF1,ALB,FBF-1
  • FBF1,ALB,FBF-1

Anti-FBF1 Antibody 100ul

Ref: AN-HPA023677-100ul
Anti-FBF1

Información del producto

Polyclonal Antibody against Human FBF1, Gene description: Fas (TNFRSF6) binding factor 1, Alternative Gene Names: ALB, FBF-1, FLJ00103, KIAA1863, Validated applications: ICC, IHC, Uniprot ID: Q8TES7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FBF1
Gene Description Fas (TNFRSF6) binding factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHP
Immunogen ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALB, FBF-1, FLJ00103, KIAA1863
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TES7
HTS Code 3002150000
Gene ID 85302
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FBF1 Antibody 100ul

Anti-FBF1 Antibody 100ul