UBE2O,E2-230K
  • UBE2O,E2-230K

Anti-UBE2O Antibody 100ul

Ref: AN-HPA023605-100ul
Anti-UBE2O

Información del producto

Polyclonal Antibody against Human UBE2O, Gene description: ubiquitin-conjugating enzyme E2O, Alternative Gene Names: E2-230K, Validated applications: ICC, WB, Uniprot ID: Q9C0C9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UBE2O
Gene Description ubiquitin-conjugating enzyme E2O
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence GVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFF
Immunogen GVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names E2-230K
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C0C9
HTS Code 3002150000
Gene ID 63893
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UBE2O Antibody 100ul

Anti-UBE2O Antibody 100ul