LBHD1,C11orf48
  • LBHD1,C11orf48

Anti-LBHD1 Antibody 100ul

Ref: AN-HPA023592-100ul
Anti-LBHD1

Información del producto

Polyclonal Antibody against Human LBHD1, Gene description: LBH domain containing 1, Alternative Gene Names: C11orf48, MGC2477, Validated applications: IHC, WB, Uniprot ID: Q9BQE6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LBHD1
Gene Description LBH domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SEAPGGRGCDRPRADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGSGSPFKASQD
Immunogen SEAPGGRGCDRPRADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGSGSPFKASQD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C11orf48, MGC2477
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQE6
HTS Code 3002150000
Gene ID 79081
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LBHD1 Antibody 100ul

Anti-LBHD1 Antibody 100ul