MSL1,DKFZp686P24239
  • MSL1,DKFZp686P24239

Anti-MSL1 Antibody 100ul

Ref: AN-HPA023567-100ul
Anti-MSL1

Información del producto

Polyclonal Antibody against Human MSL1, Gene description: male-specific lethal 1 homolog (Drosophila), Alternative Gene Names: DKFZp686P24239, hMSL1, MSL-1, Validated applications: ICC, IHC, Uniprot ID: Q68DK7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MSL1
Gene Description male-specific lethal 1 homolog (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence FGSTERKTPVKKLAPEFSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTEMY
Immunogen FGSTERKTPVKKLAPEFSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTEMY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp686P24239, hMSL1, MSL-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q68DK7
HTS Code 3002150000
Gene ID 339287
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MSL1 Antibody 100ul

Anti-MSL1 Antibody 100ul