KLHL25,ENC-2,ENC2
  • KLHL25,ENC-2,ENC2

Anti-KLHL25 Antibody 25ul

Ref: AN-HPA023450-25ul
Anti-KLHL25

Información del producto

Polyclonal Antibody against Human KLHL25, Gene description: kelch-like family member 25, Alternative Gene Names: ENC-2, ENC2, FLJ12587, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H0H3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KLHL25
Gene Description kelch-like family member 25
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence HFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADERTKLIMDEALRCKTRILQNDGVVTSPCA
Immunogen HFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADERTKLIMDEALRCKTRILQNDGVVTSPCA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ENC-2, ENC2, FLJ12587
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H0H3
HTS Code 3002150000
Gene ID 64410
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KLHL25 Antibody 25ul

Anti-KLHL25 Antibody 25ul