USP43,FLJ30626
  • USP43,FLJ30626

Anti-USP43 Antibody 25ul

Ref: AN-HPA023389-25ul
Anti-USP43

Información del producto

Polyclonal Antibody against Human USP43, Gene description: ubiquitin specific peptidase 43, Alternative Gene Names: FLJ30626, Validated applications: IHC, WB, Uniprot ID: Q70EL4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name USP43
Gene Description ubiquitin specific peptidase 43
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SNVALPANSEDGGRAIERGPAGVPCPSAQPNHCLAPGNSDGPNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARPEGQKAMNWKESFQMGSKSSPPSPYMGFSGNSK
Immunogen SNVALPANSEDGGRAIERGPAGVPCPSAQPNHCLAPGNSDGPNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARPEGQKAMNWKESFQMGSKSSPPSPYMGFSGNSK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ30626
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q70EL4
HTS Code 3002150000
Gene ID 124739
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-USP43 Antibody 25ul

Anti-USP43 Antibody 25ul