GLOD4,C17orf25
  • GLOD4,C17orf25

Anti-GLOD4 Antibody 100ul

Ref: AN-HPA023246-100ul
Anti-GLOD4

Información del producto

Polyclonal Antibody against Human GLOD4, Gene description: glyoxalase domain containing 4, Alternative Gene Names: C17orf25, CGI-150, HC71, Validated applications: ICC, IHC, WB, Uniprot ID: Q9HC38, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GLOD4
Gene Description glyoxalase domain containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, ICC, WB
Sequence KSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMK
Immunogen KSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C17orf25, CGI-150, HC71
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HC38
HTS Code 3002150000
Gene ID 51031
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GLOD4 Antibody 100ul

Anti-GLOD4 Antibody 100ul