RPS6KA4,MSK2,RSK-B
  • RPS6KA4,MSK2,RSK-B

Anti-RPS6KA4 Antibody 25ul

Ref: AN-HPA023225-25ul
Anti-RPS6KA4

Información del producto

Polyclonal Antibody against Human RPS6KA4, Gene description: ribosomal protein S6 kinase, 90kDa, polypeptide 4, Alternative Gene Names: MSK2, RSK-B, Validated applications: ICC, IHC, WB, Uniprot ID: O75676, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPS6KA4
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence AQEVRNHPFFQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYSFVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQGSFSVC
Immunogen AQEVRNHPFFQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYSFVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQGSFSVC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MSK2, RSK-B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75676
HTS Code 3002150000
Gene ID 8986
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPS6KA4 Antibody 25ul

Anti-RPS6KA4 Antibody 25ul