NUDCD1,CML66
  • NUDCD1,CML66

Anti-NUDCD1 Antibody 25ul

Ref: AN-HPA023183-25ul
Anti-NUDCD1

Información del producto

Polyclonal Antibody against Human NUDCD1, Gene description: NudC domain containing 1, Alternative Gene Names: CML66, FLJ14991, Validated applications: ICC, IHC, WB, Uniprot ID: Q96RS6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NUDCD1
Gene Description NudC domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications IHC, WB, ICC
Sequence IKKNEGLTWPELVIGDKQGELIRDSAQCAAIAERLMHLTSEELNPNPDKEKPPCNAQELEECDIFFEESSSLCRFDGNTLKTTHVVNLGSNQYL
Immunogen IKKNEGLTWPELVIGDKQGELIRDSAQCAAIAERLMHLTSEELNPNPDKEKPPCNAQELEECDIFFEESSSLCRFDGNTLKTTHVVNLGSNQYL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CML66, FLJ14991
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96RS6
HTS Code 3002150000
Gene ID 84955
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NUDCD1 Antibody 25ul

Anti-NUDCD1 Antibody 25ul