MFSD6L,FLJ35773
  • MFSD6L,FLJ35773

Anti-MFSD6L Antibody 100ul

Ref: AN-HPA023164-100ul
Anti-MFSD6L

Información del producto

Polyclonal Antibody against Human MFSD6L, Gene description: major facilitator superfamily domain containing 6-like, Alternative Gene Names: FLJ35773, Validated applications: IHC, Uniprot ID: Q8IWD5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MFSD6L
Gene Description major facilitator superfamily domain containing 6-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NRVHFPCNGSSGLTSTDALPGVTLPVNITSAQESASSHPAKRTAEVEMPGFRNPPGESDRETFRDLHVYLAPSVEGARTTS
Immunogen NRVHFPCNGSSGLTSTDALPGVTLPVNITSAQESASSHPAKRTAEVEMPGFRNPPGESDRETFRDLHVYLAPSVEGARTTS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ35773
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IWD5
HTS Code 3002150000
Gene ID 162387
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MFSD6L Antibody 100ul

Anti-MFSD6L Antibody 100ul