SLC38A10,MGC15523
  • SLC38A10,MGC15523

Anti-SLC38A10 Antibody 100ul

Ref: AN-HPA023161-100ul
Anti-SLC38A10

Información del producto

Polyclonal Antibody against Human SLC38A10, Gene description: solute carrier family 38, member 10, Alternative Gene Names: MGC15523, PP1744, Validated applications: IHC, Uniprot ID: Q9HBR0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC38A10
Gene Description solute carrier family 38, member 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPELRVISDGEQGGQQGHRLDHGGHLEMRKA
Immunogen MKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPELRVISDGEQGGQQGHRLDHGGHLEMRKA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC15523, PP1744
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HBR0
HTS Code 3002150000
Gene ID 124565
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC38A10 Antibody 100ul

Anti-SLC38A10 Antibody 100ul