MRPL12,MRPL7
  • MRPL12,MRPL7

Anti-MRPL12 Antibody 25ul

Ref: AN-HPA023043-25ul
Anti-MRPL12

Información del producto

Polyclonal Antibody against Human MRPL12, Gene description: mitochondrial ribosomal protein L12, Alternative Gene Names: MRPL7, MRPL7/L12, RPML12, Validated applications: ICC, IHC, WB, Uniprot ID: P52815, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPL12
Gene Description mitochondrial ribosomal protein L12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence PCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGG
Immunogen PCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MRPL7, MRPL7/L12, RPML12
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P52815
HTS Code 3002150000
Gene ID 6182
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPL12 Antibody 25ul

Anti-MRPL12 Antibody 25ul