MRM3,FLJ10581,HC90
  • MRM3,FLJ10581,HC90

Anti-MRM3 Antibody 100ul

Ref: AN-HPA023031-100ul
Anti-MRM3

Información del producto

Polyclonal Antibody against Human MRM3, Gene description: mitochondrial rRNA methyltransferase 3, Alternative Gene Names: FLJ10581, HC90, RMTL1, RNMTL1, Validated applications: IHC, WB, Uniprot ID: Q9HC36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRM3
Gene Description mitochondrial rRNA methyltransferase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence ILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKLKGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKMTYPKTQLQHSLPLLLICDNLRDPGN
Immunogen ILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKLKGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKMTYPKTQLQHSLPLLLICDNLRDPGN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10581, HC90, RMTL1, RNMTL1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HC36
HTS Code 3002150000
Gene ID 55178
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRM3 Antibody 100ul

Anti-MRM3 Antibody 100ul