SPOUT1,C9orf114
  • SPOUT1,C9orf114

Anti-SPOUT1 Antibody 25ul

Ref: AN-HPA022990-25ul
Anti-SPOUT1

Información del producto

Polyclonal Antibody against Human SPOUT1, Gene description: SPOUT domain containing methyltransferase 1, Alternative Gene Names: C9orf114, CENP-32, HSPC109, Validated applications: ICC, WB, Uniprot ID: Q5T280, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPOUT1
Gene Description SPOUT domain containing methyltransferase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence QYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASC
Immunogen QYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf114, CENP-32, HSPC109
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T280
HTS Code 3002150000
Gene ID 51490
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPOUT1 Antibody 25ul

Anti-SPOUT1 Antibody 25ul