DCAF7,HAN11,SWAN-1
  • DCAF7,HAN11,SWAN-1

Anti-DCAF7 Antibody 100ul

Ref: AN-HPA022962-100ul
Anti-DCAF7

Información del producto

Polyclonal Antibody against Human DCAF7, Gene description: DDB1 and CUL4 associated factor 7, Alternative Gene Names: HAN11, SWAN-1, WDR68, Validated applications: IHC, WB, Uniprot ID: P61962, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DCAF7
Gene Description DDB1 and CUL4 associated factor 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence YPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQ
Immunogen YPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HAN11, SWAN-1, WDR68
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61962
HTS Code 3002150000
Gene ID 10238
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DCAF7 Antibody 100ul

Anti-DCAF7 Antibody 100ul