C17orf49,BAP18
  • C17orf49,BAP18

Anti-C17orf49 Antibody 100ul

Ref: AN-HPA022961-100ul
Anti-C17orf49

Información del producto

Polyclonal Antibody against Human C17orf49, Gene description: chromosome 17 open reading frame 49, Alternative Gene Names: BAP18, HEPIS, MGC49942, Validated applications: ICC, IHC, WB, Uniprot ID: Q8IXM2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C17orf49
Gene Description chromosome 17 open reading frame 49
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence TSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKERTVAQIKATVKRKVYEDSGI
Immunogen TSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKERTVAQIKATVKRKVYEDSGI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BAP18, HEPIS, MGC49942
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IXM2
HTS Code 3002150000
Gene ID 124944
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C17orf49 Antibody 100ul

Anti-C17orf49 Antibody 100ul