CDK5RAP3,C53
  • CDK5RAP3,C53

Anti-CDK5RAP3 Antibody 100ul

Ref: AN-HPA022882-100ul
Anti-CDK5RAP3

Información del producto

Polyclonal Antibody against Human CDK5RAP3, Gene description: CDK5 regulatory subunit associated protein 3, Alternative Gene Names: C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114, Validated applications: IHC, WB, Uniprot ID: Q96JB5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CDK5RAP3
Gene Description CDK5 regulatory subunit associated protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQV
Immunogen ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96JB5
HTS Code 3002150000
Gene ID 80279
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CDK5RAP3 Antibody 100ul

Anti-CDK5RAP3 Antibody 100ul