ITPA,C20orf37
  • ITPA,C20orf37

Anti-ITPA Antibody 25ul

Ref: AN-HPA022824-25ul
Anti-ITPA

Información del producto

Polyclonal Antibody against Human ITPA, Gene description: inosine triphosphatase (nucleoside triphosphate pyrophosphatase), Alternative Gene Names: C20orf37, dJ794I6.3, HLC14-06-P, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BY32, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ITPA
Gene Description inosine triphosphatase (nucleoside triphosphate pyrophosphatase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence GFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA
Immunogen GFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf37, dJ794I6.3, HLC14-06-P
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BY32
HTS Code 3002150000
Gene ID 3704
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ITPA Antibody 25ul

Anti-ITPA Antibody 25ul