RSAD1,FLJ11164
  • RSAD1,FLJ11164

Anti-RSAD1 Antibody 25ul

Ref: AN-HPA022436-25ul
Anti-RSAD1

Información del producto

Polyclonal Antibody against Human RSAD1, Gene description: radical S-adenosyl methionine domain containing 1, Alternative Gene Names: FLJ11164, Validated applications: ICC, IHC, Uniprot ID: Q9HA92, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RSAD1
Gene Description radical S-adenosyl methionine domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFGANKEVQELLERGLLQLDHRGLRCSWEGLAVLDSLLLTLLP
Immunogen LLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFGANKEVQELLERGLLQLDHRGLRCSWEGLAVLDSLLLTLLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11164
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HA92
HTS Code 3002150000
Gene ID 55316
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RSAD1 Antibody 25ul

Anti-RSAD1 Antibody 25ul