RGS17,RGS-17,RGSZ2
  • RGS17,RGS-17,RGSZ2

Anti-RGS17 Antibody 100ul

Ref: AN-HPA022276-100ul
Anti-RGS17

Información del producto

Polyclonal Antibody against Human RGS17, Gene description: regulator of G-protein signaling 17, Alternative Gene Names: RGS-17, RGSZ2, Validated applications: IHC, WB, Uniprot ID: Q9UGC6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RGS17
Gene Description regulator of G-protein signaling 17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEY
Immunogen NEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RGS-17, RGSZ2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UGC6
HTS Code 3002150000
Gene ID 26575
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RGS17 Antibody 100ul

Anti-RGS17 Antibody 100ul