ZNF276,CENP-Z,CENPZ
  • ZNF276,CENP-Z,CENPZ

Anti-ZNF276 Antibody 25ul

Ref: AN-HPA022255-25ul
Anti-ZNF276

Información del producto

Polyclonal Antibody against Human ZNF276, Gene description: zinc finger protein 276, Alternative Gene Names: CENP-Z, CENPZ, MGC45417, ZADT, ZFP276, ZNF477, Validated applications: IHC, Uniprot ID: Q8N554, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF276
Gene Description zinc finger protein 276
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PWDKETAPRLPQHRGWNPGDAPQTSQGRGTGTPVGAETKTLPSTDVAQPPSDSDAVGPRSGFPPQPSLPLCRAPGQLGEKQLPSSTSDDR
Immunogen PWDKETAPRLPQHRGWNPGDAPQTSQGRGTGTPVGAETKTLPSTDVAQPPSDSDAVGPRSGFPPQPSLPLCRAPGQLGEKQLPSSTSDDR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CENP-Z, CENPZ, MGC45417, ZADT, ZFP276, ZNF477
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N554
HTS Code 3002150000
Gene ID 92822
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF276 Antibody 25ul

Anti-ZNF276 Antibody 25ul