RAP1GAP2,GARNL4
  • RAP1GAP2,GARNL4

Anti-RAP1GAP2 Antibody 25ul

Ref: AN-HPA022148-25ul
Anti-RAP1GAP2

Información del producto

Polyclonal Antibody against Human RAP1GAP2, Gene description: RAP1 GTPase activating protein 2, Alternative Gene Names: GARNL4, KIAA1039, Validated applications: IHC, Uniprot ID: Q684P5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RAP1GAP2
Gene Description RAP1 GTPase activating protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLSPPLTAPPTMKSSEFFEMLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVI
Immunogen MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLSPPLTAPPTMKSSEFFEMLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GARNL4, KIAA1039
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q684P5
HTS Code 3002150000
Gene ID 23108
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAP1GAP2 Antibody 25ul

Anti-RAP1GAP2 Antibody 25ul