ARPC5L,ARC16-2 Ver mas grande

Anti-ARPC5L Antibody 100ul

AN-HPA022013-100ul

Producto nuevo

Anti-ARPC5L

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name ARPC5L
Gene Description actin related protein 2/3 complex, subunit 5-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Immunogen NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARC16-2, MGC3038
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BPX5
HTS Code 3002150000
Gene ID 81873
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación IHC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human ARPC5L, Gene description: actin related protein 2/3 complex, subunit 5-like, Alternative Gene Names: ARC16-2, MGC3038, Validated applications: IHC, Uniprot ID: Q9BPX5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image