MFSD11,FLJ20226
  • MFSD11,FLJ20226

Anti-MFSD11 Antibody 100ul

Ref: AN-HPA022001-100ul
Anti-MFSD11

Información del producto

Polyclonal Antibody against Human MFSD11, Gene description: major facilitator superfamily domain containing 11, Alternative Gene Names: FLJ20226, FLJ22196, Validated applications: ICC, WB, Uniprot ID: O43934, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MFSD11
Gene Description major facilitator superfamily domain containing 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, ICC
Sequence DSENVLGEDESSDDQDMEVNESAQNNLTKAVDAFKKSFKLCVTKEML
Immunogen DSENVLGEDESSDDQDMEVNESAQNNLTKAVDAFKKSFKLCVTKEML
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20226, FLJ22196
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43934
HTS Code 3002150000
Gene ID 79157
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MFSD11 Antibody 100ul

Anti-MFSD11 Antibody 100ul