ANAPC11,APC11
  • ANAPC11,APC11

Anti-ANAPC11 Antibody 100ul

Ref: AN-HPA021989-100ul
Anti-ANAPC11

Información del producto

Polyclonal Antibody against Human ANAPC11, Gene description: anaphase promoting complex subunit 11, Alternative Gene Names: APC11, Apc11p, HSPC214, MGC882, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NYG5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ANAPC11
Gene Description anaphase promoting complex subunit 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence SPWCLDHSCDLFGITDQVSADGPRACRQGARRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGMEVQGV
Immunogen SPWCLDHSCDLFGITDQVSADGPRACRQGARRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGMEVQGV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APC11, Apc11p, HSPC214, MGC882
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NYG5
HTS Code 3002150000
Gene ID 51529
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ANAPC11 Antibody 100ul

Anti-ANAPC11 Antibody 100ul