CFTR,ABC35,ABCC7,CF
  • CFTR,ABC35,ABCC7,CF

Anti-CFTR Antibody 100ul

Ref: AN-HPA021939-100ul
Anti-CFTR

Información del producto

Polyclonal Antibody against Human CFTR, Gene description: cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7), Alternative Gene Names: ABC35, ABCC7, CF, CFTR/MRP, dJ760C5.1, MRP7, TNR-CFTR, Validated applications: IHC, Uniprot ID: P13569, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CFTR
Gene Description cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence INSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDL
Immunogen INSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABC35, ABCC7, CF, CFTR/MRP, dJ760C5.1, MRP7, TNR-CFTR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P13569
HTS Code 3002150000
Gene ID 1080
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CFTR Antibody 100ul

Anti-CFTR Antibody 100ul