NAT16,C7orf52
  • NAT16,C7orf52

Anti-NAT16 Antibody 100ul

Ref: AN-HPA021918-100ul
Anti-NAT16

Información del producto

Polyclonal Antibody against Human NAT16, Gene description: N-acetyltransferase 16 (GCN5-related, putative), Alternative Gene Names: C7orf52, FLJ39237, Validated applications: IHC, WB, Uniprot ID: Q8N8M0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NAT16
Gene Description N-acetyltransferase 16 (GCN5-related, putative)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LESVNVIDAGETVLVEGLRVAPWERGKGVAGLLQRFCSQLVKRQHPGVKVARLTRDDQLGPRELKKYRLITKQG
Immunogen LESVNVIDAGETVLVEGLRVAPWERGKGVAGLLQRFCSQLVKRQHPGVKVARLTRDDQLGPRELKKYRLITKQG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C7orf52, FLJ39237
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N8M0
HTS Code 3002150000
Gene ID 375607
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NAT16 Antibody 100ul

Anti-NAT16 Antibody 100ul