RNF157,KIAA1917
  • RNF157,KIAA1917

Anti-RNF157 Antibody 25ul

Ref: AN-HPA021854-25ul
Anti-RNF157

Información del producto

Polyclonal Antibody against Human RNF157, Gene description: ring finger protein 157, Alternative Gene Names: KIAA1917, Validated applications: IHC, Uniprot ID: Q96PX1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RNF157
Gene Description ring finger protein 157
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EEEDGSPTQEGQRTCAFLGMECDNNNDFDIASVKALDNKLCSEVCLPGAWQADDNAVSRNAQ
Immunogen EEEDGSPTQEGQRTCAFLGMECDNNNDFDIASVKALDNKLCSEVCLPGAWQADDNAVSRNAQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1917
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96PX1
HTS Code 3002150000
Gene ID 114804
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RNF157 Antibody 25ul

Anti-RNF157 Antibody 25ul