HSD17B2,HSD17,SDR9C2
  • HSD17B2,HSD17,SDR9C2

Anti-HSD17B2 Antibody 25ul

Ref: AN-HPA021826-25ul
Anti-HSD17B2

Información del producto

Polyclonal Antibody against Human HSD17B2, Gene description: hydroxysteroid (17-beta) dehydrogenase 2, Alternative Gene Names: HSD17, SDR9C2, Validated applications: ICC, IHC, WB, Uniprot ID: P37059, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HSD17B2
Gene Description hydroxysteroid (17-beta) dehydrogenase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence AVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVL
Immunogen AVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSD17, SDR9C2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P37059
HTS Code 3002150000
Gene ID 3294
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HSD17B2 Antibody 25ul

Anti-HSD17B2 Antibody 25ul