GOLGA2,GM130
  • GOLGA2,GM130

Anti-GOLGA2 Antibody 25ul

Ref: AN-HPA021799-25ul
Anti-GOLGA2

Información del producto

Polyclonal Antibody against Human GOLGA2, Gene description: golgin A2, Alternative Gene Names: GM130, golgin-95, Validated applications: ICC, IHC, WB, Uniprot ID: Q08379, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GOLGA2
Gene Description golgin A2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence DTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLK
Immunogen DTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GM130, golgin-95
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q08379
HTS Code 3002150000
Gene ID 2801
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GOLGA2 Antibody 25ul

Anti-GOLGA2 Antibody 25ul