ANKRD40,MGC15396
  • ANKRD40,MGC15396

Anti-ANKRD40 Antibody 100ul

Ref: AN-HPA021759-100ul
Anti-ANKRD40

Información del producto

Polyclonal Antibody against Human ANKRD40, Gene description: ankyrin repeat domain 40, Alternative Gene Names: MGC15396, Validated applications: ICC, IHC, WB, Uniprot ID: Q6AI12, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ANKRD40
Gene Description ankyrin repeat domain 40
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence IMGVEEEDDDDDDDDNLPQLKKESELPFVPNYLANPAFPFIYTPTAEDSAQMQNGGPSTPPASPPADGSPPLLP
Immunogen IMGVEEEDDDDDDDDNLPQLKKESELPFVPNYLANPAFPFIYTPTAEDSAQMQNGGPSTPPASPPADGSPPLLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC15396
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6AI12
HTS Code 3002150000
Gene ID 91369
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ANKRD40 Antibody 100ul

Anti-ANKRD40 Antibody 100ul