KLHL41,KBTBD10,Krp1
  • KLHL41,KBTBD10,Krp1

Anti-KLHL41 Antibody 100ul

Ref: AN-HPA021753-100ul
Anti-KLHL41

Información del producto

Polyclonal Antibody against Human KLHL41, Gene description: kelch-like family member 41, Alternative Gene Names: KBTBD10, Krp1, SARCOSIN, Validated applications: ICC, IHC, WB, Uniprot ID: O60662, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KLHL41
Gene Description kelch-like family member 41
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence GDKSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQD
Immunogen GDKSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KBTBD10, Krp1, SARCOSIN
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60662
HTS Code 3002150000
Gene ID 10324
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KLHL41 Antibody 100ul

Anti-KLHL41 Antibody 100ul