RACK1,Gnb2-rs1
  • RACK1,Gnb2-rs1

Anti-RACK1 Antibody 100ul

Ref: AN-HPA021676-100ul
Anti-RACK1

Información del producto

Polyclonal Antibody against Human RACK1, Gene description: receptor for activated C kinase 1, Alternative Gene Names: Gnb2-rs1, GNB2L1, H12.3, Validated applications: ICC, WB, Uniprot ID: P63244, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RACK1
Gene Description receptor for activated C kinase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications WB, ICC
Sequence CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG
Immunogen CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Gnb2-rs1, GNB2L1, H12.3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P63244
HTS Code 3002150000
Gene ID 10399
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RACK1 Antibody 100ul

Anti-RACK1 Antibody 100ul