CERCAM,CEECAM1
  • CERCAM,CEECAM1

Anti-CERCAM Antibody 25ul

Ref: AN-HPA021657-25ul
Anti-CERCAM

Información del producto

Polyclonal Antibody against Human CERCAM, Gene description: cerebral endothelial cell adhesion molecule, Alternative Gene Names: CEECAM1, CerCAM, GLT25D3, Validated applications: IHC, Uniprot ID: Q5T4B2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CERCAM
Gene Description cerebral endothelial cell adhesion molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDG
Immunogen TFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CEECAM1, CerCAM, GLT25D3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T4B2
HTS Code 3002150000
Gene ID 51148
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CERCAM Antibody 25ul

Anti-CERCAM Antibody 25ul